KEGG   Vulpes lagopus (Arctic fox): 121479474
Entry
121479474         CDS       T07435                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
vlg  Vulpes lagopus (Arctic fox)
Pathway
vlg04010  MAPK signaling pathway
vlg04014  Ras signaling pathway
vlg04015  Rap1 signaling pathway
vlg04024  cAMP signaling pathway
vlg04062  Chemokine signaling pathway
vlg04071  Sphingolipid signaling pathway
vlg04145  Phagosome
vlg04148  Efferocytosis
vlg04151  PI3K-Akt signaling pathway
vlg04310  Wnt signaling pathway
vlg04360  Axon guidance
vlg04370  VEGF signaling pathway
vlg04380  Osteoclast differentiation
vlg04510  Focal adhesion
vlg04520  Adherens junction
vlg04530  Tight junction
vlg04613  Neutrophil extracellular trap formation
vlg04620  Toll-like receptor signaling pathway
vlg04650  Natural killer cell mediated cytotoxicity
vlg04662  B cell receptor signaling pathway
vlg04664  Fc epsilon RI signaling pathway
vlg04666  Fc gamma R-mediated phagocytosis
vlg04670  Leukocyte transendothelial migration
vlg04722  Neurotrophin signaling pathway
vlg04810  Regulation of actin cytoskeleton
vlg04932  Non-alcoholic fatty liver disease
vlg04933  AGE-RAGE signaling pathway in diabetic complications
vlg04972  Pancreatic secretion
vlg05014  Amyotrophic lateral sclerosis
vlg05020  Prion disease
vlg05022  Pathways of neurodegeneration - multiple diseases
vlg05100  Bacterial invasion of epithelial cells
vlg05132  Salmonella infection
vlg05135  Yersinia infection
vlg05163  Human cytomegalovirus infection
vlg05167  Kaposi sarcoma-associated herpesvirus infection
vlg05169  Epstein-Barr virus infection
vlg05170  Human immunodeficiency virus 1 infection
vlg05200  Pathways in cancer
vlg05203  Viral carcinogenesis
vlg05205  Proteoglycans in cancer
vlg05208  Chemical carcinogenesis - reactive oxygen species
vlg05210  Colorectal cancer
vlg05211  Renal cell carcinoma
vlg05212  Pancreatic cancer
vlg05231  Choline metabolism in cancer
vlg05415  Diabetic cardiomyopathy
vlg05416  Viral myocarditis
vlg05417  Lipid and atherosclerosis
vlg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vlg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    121479474
   04014 Ras signaling pathway
    121479474
   04015 Rap1 signaling pathway
    121479474
   04310 Wnt signaling pathway
    121479474
   04370 VEGF signaling pathway
    121479474
   04071 Sphingolipid signaling pathway
    121479474
   04024 cAMP signaling pathway
    121479474
   04151 PI3K-Akt signaling pathway
    121479474
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    121479474
   04148 Efferocytosis
    121479474
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    121479474
   04520 Adherens junction
    121479474
   04530 Tight junction
    121479474
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    121479474
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    121479474
   04620 Toll-like receptor signaling pathway
    121479474
   04650 Natural killer cell mediated cytotoxicity
    121479474
   04662 B cell receptor signaling pathway
    121479474
   04664 Fc epsilon RI signaling pathway
    121479474
   04666 Fc gamma R-mediated phagocytosis
    121479474
   04670 Leukocyte transendothelial migration
    121479474
   04062 Chemokine signaling pathway
    121479474
  09154 Digestive system
   04972 Pancreatic secretion
    121479474
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    121479474
  09158 Development and regeneration
   04360 Axon guidance
    121479474
   04380 Osteoclast differentiation
    121479474
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    121479474
   05205 Proteoglycans in cancer
    121479474
   05208 Chemical carcinogenesis - reactive oxygen species
    121479474
   05203 Viral carcinogenesis
    121479474
   05231 Choline metabolism in cancer
    121479474
  09162 Cancer: specific types
   05210 Colorectal cancer
    121479474
   05212 Pancreatic cancer
    121479474
   05211 Renal cell carcinoma
    121479474
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    121479474
   05163 Human cytomegalovirus infection
    121479474
   05167 Kaposi sarcoma-associated herpesvirus infection
    121479474
   05169 Epstein-Barr virus infection
    121479474
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    121479474
   05135 Yersinia infection
    121479474
   05100 Bacterial invasion of epithelial cells
    121479474
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    121479474
   05020 Prion disease
    121479474
   05022 Pathways of neurodegeneration - multiple diseases
    121479474
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    121479474
   05418 Fluid shear stress and atherosclerosis
    121479474
   05415 Diabetic cardiomyopathy
    121479474
   05416 Viral myocarditis
    121479474
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    121479474
   04933 AGE-RAGE signaling pathway in diabetic complications
    121479474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vlg04131]
    121479474
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vlg04147]
    121479474
   04031 GTP-binding proteins [BR:vlg04031]
    121479474
Membrane trafficking [BR:vlg04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    121479474
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    121479474
  Macropinocytosis
   Ras GTPases
    121479474
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    121479474
Exosome [BR:vlg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   121479474
  Exosomal proteins of other body fluids (saliva and urine)
   121479474
  Exosomal proteins of colorectal cancer cells
   121479474
  Exosomal proteins of bladder cancer cells
   121479474
GTP-binding proteins [BR:vlg04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    121479474
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 121479474
NCBI-ProteinID: XP_041591038
LinkDB
Position
20:31213178..31213678
AA seq 118 aa
KNVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKL
TPVTYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 357 nt   +upstreamnt  +downstreamnt
aaaaatgtattcttaatttgcttttctcttgtgagtcctgcatcatttgaaaatgttcga
gcaaagtggtaccctgaagtgcgacaccactgtcccaacacccctatcatcttggtgggg
actaaacttgatctcagggatgacaaagacacgattgagaaactgaaggagaagaagctg
actcccgtcacctacccacagggtctggccatggctaaggagatcggtgctgtaaaatac
ctggagtgctctgctctcacgcagcgaggcctcaagacagtgtttgatgaagctattcga
gcggttctctgcccccctcccgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system