Vulpes lagopus (Arctic fox): 121479514 Help Entry 121479514         CDS       T07435                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism vlg  Vulpes lagopus (Arctic fox) Brite KEGG Orthology (KO) [BR:vlg00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:vlg01002]     121479514 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121479514 (CSTB) Peptidases and inhibitors [BR:vlg01002]  Peptidase inhibitors   Family I25: cystatin family    121479514 (CSTB) Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    121479514 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Dynein_light DUF6195 Motif Other DBs NCBI-GeneID:  121479514 NCBI-ProteinID:  XP_041591110 LinkDB All DBs Position 20:2204912..2208151 Genome browser AA seq 98 aa AA seqDB search MMCGAPSASQPATADTQAIADQVKAQLEERENKKYTTFKAVTFRSQVVAGTNYFIKVQVD DDEFVHLRVFQSLPHENKPLALSSYQTNKAKHDELAYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggagcgcccagcgcctcgcagcccgccacggccgacacccaggccatcgcc gaccaggtgaaggcccagctggaagagcgggaaaataagaagtacactacttttaaggcc gtgacattcaggagccaggtggtcgcggggacaaactacttcatcaaggtccaagttgac gatgacgagtttgtgcaccttcgagtatttcagagtctcccgcatgagaacaagcccttg gccttgtccagctatcagaccaacaaagccaagcacgacgagctggcgtacttctag

DBGET integrated database retrieval system