Vulpes lagopus (Arctic fox): 121480661 Help Entry 121480661         CDS       T07435                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04360   Axon guidance vlg04666   Fc gamma R-mediated phagocytosis vlg04810   Regulation of actin cytoskeleton vlg05133   Pertussis vlg05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:vlg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121480661  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     121480661   09158 Development and regeneration    04360 Axon guidance     121480661  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121480661   09171 Infectious disease: bacterial    05133 Pertussis     121480661  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121480661   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vlg04812]     121480661    04147 Exosome [BR:vlg04147]     121480661 Membrane trafficking [BR:vlg04131]  Others   Actin-binding proteins    Others     121480661 Cytoskeleton proteins [BR:vlg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      121480661 Exosome [BR:vlg04147]  Exosomal proteins   Proteins found in most exosomes    121480661 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Mt_ATP-synt_B RPA_interact_N Motif Other DBs NCBI-GeneID:  121480661 NCBI-ProteinID:  XP_041593337 LinkDB All DBs Position 22:11087195..11089305 Genome browser AA seq 148 aa AA seqDB search MKVCKFPTPEEVKKHKKAVLLCLGEDKKNIILEEGKEILVGDVGQTVDHPYATLVKMLPD KDCYVLYNTTYETKESKKEGLVFTFWAPKSAPLKSKMIYASSKDAIKKKLTGIKHELQAN CYEEVKDRCTLAEKLGGSAVMSLEGKPL NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgtgtaagttcccaacaccagaggaggtgaagaagcacaagaaggcagtactt ctctgcctcggcgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggta ggtgatgtgggccagactgtagaccacccctatgccacccttgtcaagatgctaccagac aaggactgctatgtcctctataacacaacctatgagaccaaggagagcaagaaggagggc ctggtgtttaccttctgggcacctaagtctgccccccttaagagcaaaatgatttatgcc agctccaaggatgccatcaagaaaaagctgaccgggatcaagcatgaattacaagcaaac tgctatgaagaggtgaaggaccgctgcaccctggcagagaaactggggggcagtgctgtc atgtccctggagggcaagcctttgtga

DBGET integrated database retrieval system