Vulpes lagopus (Arctic fox): 121483466 Help Entry 121483466         CDS       T07435                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04613   Neutrophil extracellular trap formation vlg05034   Alcoholism vlg05202   Transcriptional misregulation in cancer vlg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121483466  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     121483466   09163 Immune disease    05322 Systemic lupus erythematosus     121483466   09165 Substance dependence    05034 Alcoholism     121483466  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vlg03036]     121483466   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121483466 Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121483466 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121483466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  121483466 NCBI-ProteinID:  XP_041597970 LinkDB All DBs Position X:111993773..111994613 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctatccatgccaaacgtgtcacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system