KEGG   Vulpes lagopus (Arctic fox): 121486102
Entry
121486102         CDS       T07435                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
vlg  Vulpes lagopus (Arctic fox)
Pathway
vlg04610  Complement and coagulation cascades
vlg04810  Regulation of actin cytoskeleton
vlg05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:vlg00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    121486102 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    121486102 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    121486102 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:vlg04515]
    121486102 (ITGAX)
   04090 CD molecules [BR:vlg04090]
    121486102 (ITGAX)
Cell adhesion molecules [BR:vlg04515]
 Integrins
  Integrin alpha subunits
   121486102 (ITGAX)
CD molecules [BR:vlg04090]
 Proteins
  121486102 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 121486102
NCBI-ProteinID: XP_041602765
LinkDB
Position
3:complement(105826053..105860265)
AA seq 1168 aa
MSNLLVMTRTRISLLLLMALASSLCFNLDTEQPKSFLMESAGFGHSVVQYDNSWVVVGAP
QEIKAANQTGGLYQCDYSTGKCEPIQLQVPLEAVNMSLGLSLAASTKPSQLLACGPTVHH
TCNENIYLTGFCFLLGSPSWQAQRLPAALQECPKQEQDIVFLIDGSGSISSRDFIKMLNF
VEAVMSQFQRPSTQFSLMQFSNNFRVHFTFKDFTYSSNPLALLDSVSQLGGLTHTATAIR
IVTNELFSASKGARKDASKILIVITDGQKKGDSLGYEDVIPMAEAAGIIRYAVGVGTAFQ
KMQSWKELNDIASKPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFEMEMSQ
EGFSAVFTPDGPVLGAVGSFSWSGGAFLYPPKTSPTFINMSQENVDMRDSYLGYSAELAF
WKGVQSLILGAPRHQHTGKVVIFTQASEQWRPKAEVSGTQIGSYFGASLCTVDVDRDGNT
DLVLIGAPHYYKPTQGGQVSVCPLPQGRAKWQCEVILRGEQGHPWGRFGAALTVLGDVNG
DKLTDVAIGAPGEQENRGAVYLFHGISGPSISSSHSQRISGSQLSPSLQYFGQSLSGGQD
LTMDGLVDLAVGAQRQVLLLRTRPVLRVWMSIQFKPTEIARSISECREKTSSVKALGDAN
VCLHIYESPKNRLGEGDLQSSVTFDLTLDPGRQSPRAIFEETKTRNLTRVQVLGLRQYCE
TVKLLLLACVEDTVTPITLRLNFSLVGKPIPSFGSLRPMLAVDAQRYFTASLPFEKNCGT
DHVCQDDLGISFNFSGLQTLVVGSTLELNMNVMVWNDGEDSYGTTVTFFYPPGLSYRRVV
ESKSQLQPHSPRLTCDGIPAQGQGTQSTRCSINHLILREGAQITFTVTFDVSPKAMLGDR
LLLTANVSSENNTPRTSKSTFQLELVVKYAVYIVISSHEQSTKYLNFSASDQEKSSQAHH
RYQVNNLGQRDLPISINFSVPVELNGMPVWTNLEIFHPQNPSIQCSLERTVHTESDFLTH
IQKNSVVNCSIADCMRFHCDFPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEIT
FNRSVYSQIPGQEAFLTAQVETVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKAGFF
KRQYKEMMAEANGQVAPENGTSDPQVAQ
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgtctaaccttctagtcatgaccaggaccagaatatccctccttctattgatggccttg
gcttcttctctctgcttcaacttggacacggaacagccaaaaagcttccttatggagagt
gctggatttggacacagcgtggtccagtatgacaactcctgggtggtagttggagccccc
caggagataaaggctgccaaccaaacaggtggcctctaccaatgtgactacagcaccggc
aagtgtgagcccatccaactgcaggtccccttggaagctgtgaacatgtccctgggcctg
tctctggcagcctccactaaaccctctcagctgctggcctgtggccccacagtgcaccat
acatgcaacgagaacatatacttgactgggttctgcttcctgctgggctccccttcctgg
caagcccagaggctcccagctgccctgcaggagtgtccgaagcaagagcaggatatcgtg
ttcctgatcgacggctcgggcagcatctcctcccgtgattttatcaagatgttgaatttc
gtggaggctgtgatgagccagttccagagacctagcacccagttctccctgatgcagttt
tccaacaatttccgggtgcacttcactttcaaagacttcacatacagctcaaacccgcta
gccctgttggattctgtatcccagctaggagggctcactcacacagccacagccatcaga
atagtcacaaacgaactgttcagtgcctcaaaaggggcccgaaaagatgcctccaagatc
ctcattgtcattaccgatgggcagaaaaaaggagatagcctgggttatgaagatgtcatc
cctatggctgaggctgcgggtatcatccgctatgcagttggggtaggaacagcttttcaa
aaaatgcagtcctggaaagaattaaatgacattgcatcgaagccctcccatgagtacatt
tttaaagtggagaattttgatgctttgagagacattcaaaaccaactgaaagagaagatc
tttgccattgagggtacgcagaccataagcagtagttcctttgaaatggagatgtcccag
gagggcttcagcgctgtgttcacacctgatggaccagttctgggggctgtggggagcttc
agctggtctggaggtgccttcctgtaccccccaaagacgagccccactttcatcaacatg
tctcaagagaatgtggacatgagggactcttacctgggttactccgctgagctggccttt
tggaagggagtacagagcctgatcctgggggccccccgccatcagcacaccgggaaggtt
gtcatcttcactcaggcatctgagcaatggaggccgaaggctgaagtctcagggacccag
attggctcctactttggggcctccctctgcacagtggatgtggatagagatggcaacact
gacctcgtcctcatcggggctccccattactacaagccgacccaggggggccaggtgtct
gtgtgccccttgccccaggggagggcgaagtggcagtgtgaggtcattctccgtggggag
caaggccacccctggggccgttttggggcagccctgacagtgctgggggatgtgaatggg
gacaagctgacagacgtggccatcggagcgccaggagagcaggagaaccgaggtgctgtc
tacctatttcatggaatctcaggacctagcatcagctcctcccacagtcagaggatctca
ggctcccagctctcccccagcctccagtattttgggcagtcactgagtgggggtcaggac
cttaccatggatggactggtggacctggctgtgggcgcccagagacaagtgctgctgctc
aggaccagacctgtgctcagggtgtggatgagcatacaattcaaacctacagagatagcc
aggtctatatctgagtgtcgggaaaagacttcctctgtcaaggcactgggtgatgccaat
gtctgccttcatatttatgaaagtcccaagaatcggctgggtgaaggtgacctccaaagc
tctgtgacctttgaccttactcttgacccgggccgccagagtccccgtgccatctttgag
gagacaaagacccggaatctgactcgtgtgcaagtccttggcctgagacagtactgtgag
accgtgaagttgctcctcctggcctgtgtggaggacacggtcacccccatcaccttgcgt
ctcaacttctccctggtgggcaagcctatcccttcatttggaagccttcggcctatgttg
gctgtggatgctcagagatacttcacagcctctctcccctttgagaagaattgtggaact
gaccatgtctgccaggatgaccttggcatttcctttaacttctcaggattgcagaccctg
gtggtggggagtaccctggagctgaacatgaacgtgatggtgtggaatgatggtgaggac
tcctatggaaccacagtcaccttcttctacccaccagggctgtcttatcgacgtgtggta
gagagcaagagccagctacagccacactccccacgcctgacctgtgatggcatcccagcc
cagggccagggtactcagagcacccgctgcagcatcaaccacctcatcctccgtgaaggt
gcccagatcaccttcacagtcacgtttgacgtctctcccaaggccatgctgggagaccgg
ttgcttctgacagctaatgtgagcagtgaaaataacactcccaggaccagcaagagcacc
tttcagttggagctcgtggtgaagtatgccgtctacatcgtgatcagcagccacgaacag
tccactaagtacctcaacttctcagcctcagaccaggagaaaagcagccaggctcaccat
agataccaggtcaacaacctgggacagagggacctgcctatcagcatcaatttctctgtg
cctgtggagctgaatgggatgcctgtgtggacgaacttagagatcttccacccccagaac
ccatccattcagtgctctttagagagaacagtgcacacagaatctgacttcctgacccac
attcagaagaattctgtggtgaactgctccattgctgactgcatgaggttccactgtgat
ttcccctcctttggcatccaggaggaacttgacttcattctgaagggcaacctcagcttt
ggttgggtcagccagacattgcagaagaaggtattggtcgtgagtgtggctgaaatcaca
ttcaacagatctgtgtattcccagattccaggacaagaggcattcttgacagctcaggtg
gagacggtattggagaagtatgaggtctacaaccccatccccattattgttggaagctct
gtgggaggactgctgctgttggctctcatcacagccatcctatacaaggctggcttcttc
aaacgtcagtataaggaaatgatggcagaagcaaacggacaggttgccccagaaaatggg
acatcagatcctcaagttgcccaataa

DBGET integrated database retrieval system