Vulpes lagopus (Arctic fox): 121487467 Help Entry 121487467         CDS       T07435                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04613   Neutrophil extracellular trap formation vlg05034   Alcoholism vlg05202   Transcriptional misregulation in cancer vlg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121487467  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     121487467   09163 Immune disease    05322 Systemic lupus erythematosus     121487467   09165 Substance dependence    05034 Alcoholism     121487467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vlg03036]     121487467   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121487467 Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121487467 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121487467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121487467 NCBI-ProteinID:  XP_041605150 LinkDB All DBs Position 3:complement(119306390..119306832) Genome browser AA seq 136 aa AA seqDB search MPRTKQTACKSTGGKAPRKQLAAKAARKSASSTGGVKKPHRYRPGTVPLREIRRYQKSTD LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLAGLFVDTNLCAIHAKRVTI MPKDIQLARHIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgcctcgtacaaagcagactgcctgcaaatcgaccggtggcaaagcaccgaggaagcaa ctggctgcaaaagccgctcgcaagagtgcgtcctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtgccactccgtgaaattagacgttatcagaagtccactgac cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggcgggcctctttgtagacaccaacctgtgtgctatccatgccaaacgtgtcacgatt atgccaaaagacatccagctagcacgccacatacgtggagaacgtgcttaa

DBGET integrated database retrieval system