Vulpes lagopus (Arctic fox): 121490345 Help Entry 121490345         CDS       T07435                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04382   Cornified envelope formation vlg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121490345  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121490345  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121490345 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of microglial cells    121490345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EFhand_Ca_insen TMP_3 Motif Other DBs NCBI-GeneID:  121490345 NCBI-ProteinID:  XP_041609902 LinkDB All DBs Position 1:complement(92858664..92858957) Genome browser AA seq 97 aa AA seqDB search MPFQMEHVMETMMFTFHKFAGVRGYLTKEDLRILMEKEFPGFLENQKDPLAMDKIMKDLG QCQDGKVDFQSFFSLIARLTIACNDYFVIQMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccctttcaaatggagcatgtcatggaaaccatgatgttcacatttcacaagtttgct ggggttagaggctatttaacaaaggaggacctgagaatactcatggaaaaggagtttcct ggctttttagaaaatcaaaaagaccccctggccatggacaaaataatgaaggacctaggc cagtgccaagatggcaaagtggacttccagagcttcttttcactaattgctaggctcacc attgcatgcaatgactattttgtaatacagatgaaacagaagggaaggaaatag

DBGET integrated database retrieval system