Vulpes lagopus (Arctic fox): 121491079 Help Entry 121491079         CDS       T07435                                  Name (RefSeq) histone H2B type 2-F isoform X1   KO K11252   histone H2B Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04613   Neutrophil extracellular trap formation vlg05034   Alcoholism vlg05203   Viral carcinogenesis vlg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121491079  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     121491079   09163 Immune disease    05322 Systemic lupus erythematosus     121491079   09165 Substance dependence    05034 Alcoholism     121491079  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vlg03036]     121491079   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121491079 Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121491079 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121491079 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  121491079 NCBI-ProteinID:  XP_041611426 LinkDB All DBs Position 5:75000150..75017980 Genome browser AA seq 131 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSKNSKYV NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcaaaatcggctcccgctcccaagaagggttccaaaaaggctgtcacg aaagtgcaaaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctccaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaaaaacagcaagtatgtgtag

DBGET integrated database retrieval system