Vulpes lagopus (Arctic fox): 121491264 Help Entry 121491264         CDS       T07435                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04014   Ras signaling pathway vlg04137   Mitophagy - animal vlg04144   Endocytosis vlg04145   Phagosome vlg04148   Efferocytosis vlg04962   Vasopressin-regulated water reabsorption vlg05132   Salmonella infection vlg05146   Amoebiasis vlg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121491264 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121491264 (RAB5B)    04145 Phagosome     121491264 (RAB5B)    04137 Mitophagy - animal     121491264 (RAB5B)    04148 Efferocytosis     121491264 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     121491264 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121491264 (RAB5B)    05152 Tuberculosis     121491264 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     121491264 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121491264 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121491264 (RAB5B)    04031 GTP-binding proteins [BR:vlg04031]     121491264 (RAB5B) Membrane trafficking [BR:vlg04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     121491264 (RAB5B)  Endosome - Lysosome transport     121491264 (RAB5B) Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121491264 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    121491264 (RAB5B)   Exosomal proteins of colorectal cancer cells    121491264 (RAB5B)   Exosomal proteins of melanoma cells    121491264 (RAB5B) GTP-binding proteins [BR:vlg04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     121491264 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  121491264 NCBI-ProteinID:  XP_041611895 LinkDB All DBs Position 5:complement(69322006..69340475) Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgctcgagcaaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgatctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgttcatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggctatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system