Vulpes lagopus (Arctic fox): 121492166 Help Entry 121492166         CDS       T07435                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121492166 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vlg03037]     121492166 (CBY1) Cilium and associated proteins [BR:vlg03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    121492166 (CBY1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  121492166 NCBI-ProteinID:  XP_041613430 LinkDB All DBs Position 5:complement(9971614..9977548) Genome browser AA seq 127 aa AA seqDB search MPLFGNTFSPKKTPPRKSASLSNLHNLDRSTKEVELGLDYGTPTMNLAGQSLKFENGQWI AETGISEDVDRREAQRLRRRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELEELK SISHRRK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcctctctttgggaatacgttcagtcctaagaaaacgccccctcggaagtccgcttct ctctccaacctgcataatctggatcgatcaaccaaggaggtcgagctgggcctggattat ggaacccccaccatgaacctggcgggccaaagcctgaagtttgaaaatggccagtggata gcagagacggggattagtgaagatgtggaccggagggaggctcagcggctccgcaggcgg aaccagcagttggaggaagaaaacaatctcttgaggctaaaggtggacatcctgctggac atgctgtctgagaccactgctgagtcccacttaatggagaaggaattggaggagctgaag agcatcagtcacaggaggaaatga

DBGET integrated database retrieval system