Vulpes lagopus (Arctic fox): 121493914 Help Entry 121493914         CDS       T07435                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04024   cAMP signaling pathway vlg04062   Chemokine signaling pathway vlg04064   NF-kappa B signaling pathway vlg04210   Apoptosis vlg04380   Osteoclast differentiation vlg04620   Toll-like receptor signaling pathway vlg04621   NOD-like receptor signaling pathway vlg04622   RIG-I-like receptor signaling pathway vlg04623   Cytosolic DNA-sensing pathway vlg04625   C-type lectin receptor signaling pathway vlg04657   IL-17 signaling pathway vlg04658   Th1 and Th2 cell differentiation vlg04659   Th17 cell differentiation vlg04660   T cell receptor signaling pathway vlg04662   B cell receptor signaling pathway vlg04668   TNF signaling pathway vlg04722   Neurotrophin signaling pathway vlg04920   Adipocytokine signaling pathway vlg04926   Relaxin signaling pathway vlg04931   Insulin resistance vlg04936   Alcoholic liver disease vlg05132   Salmonella infection vlg05134   Legionellosis vlg05135   Yersinia infection vlg05140   Leishmaniasis vlg05142   Chagas disease vlg05145   Toxoplasmosis vlg05160   Hepatitis C vlg05161   Hepatitis B vlg05162   Measles vlg05163   Human cytomegalovirus infection vlg05164   Influenza A vlg05166   Human T-cell leukemia virus 1 infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05168   Herpes simplex virus 1 infection vlg05169   Epstein-Barr virus infection vlg05170   Human immunodeficiency virus 1 infection vlg05171   Coronavirus disease - COVID-19 vlg05200   Pathways in cancer vlg05203   Viral carcinogenesis vlg05208   Chemical carcinogenesis - reactive oxygen species vlg05215   Prostate cancer vlg05220   Chronic myeloid leukemia vlg05222   Small cell lung cancer vlg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vlg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     121493914 (NFKBIA)    04668 TNF signaling pathway     121493914 (NFKBIA)    04024 cAMP signaling pathway     121493914 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121493914 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121493914 (NFKBIA)    04621 NOD-like receptor signaling pathway     121493914 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     121493914 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     121493914 (NFKBIA)    04625 C-type lectin receptor signaling pathway     121493914 (NFKBIA)    04660 T cell receptor signaling pathway     121493914 (NFKBIA)    04658 Th1 and Th2 cell differentiation     121493914 (NFKBIA)    04659 Th17 cell differentiation     121493914 (NFKBIA)    04657 IL-17 signaling pathway     121493914 (NFKBIA)    04662 B cell receptor signaling pathway     121493914 (NFKBIA)    04062 Chemokine signaling pathway     121493914 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     121493914 (NFKBIA)    04926 Relaxin signaling pathway     121493914 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     121493914 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     121493914 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121493914 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     121493914 (NFKBIA)    05203 Viral carcinogenesis     121493914 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121493914 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     121493914 (NFKBIA)    05215 Prostate cancer     121493914 (NFKBIA)    05222 Small cell lung cancer     121493914 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121493914 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     121493914 (NFKBIA)    05161 Hepatitis B     121493914 (NFKBIA)    05160 Hepatitis C     121493914 (NFKBIA)    05171 Coronavirus disease - COVID-19     121493914 (NFKBIA)    05164 Influenza A     121493914 (NFKBIA)    05162 Measles     121493914 (NFKBIA)    05168 Herpes simplex virus 1 infection     121493914 (NFKBIA)    05163 Human cytomegalovirus infection     121493914 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     121493914 (NFKBIA)    05169 Epstein-Barr virus infection     121493914 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     121493914 (NFKBIA)    05135 Yersinia infection     121493914 (NFKBIA)    05134 Legionellosis     121493914 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121493914 (NFKBIA)    05140 Leishmaniasis     121493914 (NFKBIA)    05142 Chagas disease     121493914 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121493914 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121493914 (NFKBIA)    04931 Insulin resistance     121493914 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:vlg03000]     121493914 (NFKBIA)    04131 Membrane trafficking [BR:vlg04131]     121493914 (NFKBIA) Transcription factors [BR:vlg03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     121493914 (NFKBIA) Membrane trafficking [BR:vlg04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     121493914 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  121493914 NCBI-ProteinID:  XP_041616201 LinkDB All DBs Position 6:59682785..59686044 Genome browser AA seq 314 aa AA seqDB search MFQQAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcaagccgagcacgcccaggactgggccatggaggggccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagctggtgaaggagctgcgggagatccggctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggccctgaccatggaagtggtccgccaagtgaagggcgac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagcgtg ggagtcctgactcagacttgcaggacccagcacctctactccatcctccaggccaccaac tacaatggtcacacatgtctacatttagcttctatccatggctatttgggcattgtggag cttctggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc ctccatcttgcagtggacctgcagaattctgaccttgtgtcgcttttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctactccccgtaccagctcacgtggggtcgc ccaagcacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcttgacgttatga

DBGET integrated database retrieval system