Vulpes lagopus (Arctic fox): 121494780 Help Entry 121494780         CDS       T07435                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04137   Mitophagy - animal vlg04140   Autophagy - animal vlg04144   Endocytosis vlg04145   Phagosome vlg04148   Efferocytosis vlg05132   Salmonella infection vlg05146   Amoebiasis vlg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:vlg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121494780 (RAB7A)    04145 Phagosome     121494780 (RAB7A)    04140 Autophagy - animal     121494780 (RAB7A)    04137 Mitophagy - animal     121494780 (RAB7A)    04148 Efferocytosis     121494780 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121494780 (RAB7A)    05152 Tuberculosis     121494780 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     121494780 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121494780 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121494780 (RAB7A)    04031 GTP-binding proteins [BR:vlg04031]     121494780 (RAB7A) Membrane trafficking [BR:vlg04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121494780 (RAB7A) Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121494780 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    121494780 (RAB7A)   Exosomal proteins of colorectal cancer cells    121494780 (RAB7A)   Exosomal proteins of bladder cancer cells    121494780 (RAB7A) GTP-binding proteins [BR:vlg04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121494780 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  121494780 NCBI-ProteinID:  XP_041617619 LinkDB All DBs Position 7:complement(55482212..55552353) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggccaggaaaggttccagtcccttggtgtggccttctacagaggt gcagactgctgcgttctggtatttgacgttactgcccccaacacattcaaaaccctcgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccctttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aatgtggagcaggcgttccagacgattgcaaggaatgcacttaaacaggaaacagaggtg gagctgtacaatgaattccccgaacccatcaaactggacaagaacgaccgggccaagacc tcagcggaaagctgcagttgctga

DBGET integrated database retrieval system