Vulpes lagopus (Arctic fox): 121495364 Help Entry 121495364         CDS       T07435                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04060   Cytokine-cytokine receptor interaction vlg04151   PI3K-Akt signaling pathway vlg04217   Necroptosis vlg04620   Toll-like receptor signaling pathway vlg04621   NOD-like receptor signaling pathway vlg04622   RIG-I-like receptor signaling pathway vlg04623   Cytosolic DNA-sensing pathway vlg04630   JAK-STAT signaling pathway vlg04650   Natural killer cell mediated cytotoxicity vlg04936   Alcoholic liver disease vlg05152   Tuberculosis vlg05160   Hepatitis C vlg05161   Hepatitis B vlg05162   Measles vlg05163   Human cytomegalovirus infection vlg05164   Influenza A vlg05165   Human papillomavirus infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05168   Herpes simplex virus 1 infection vlg05169   Epstein-Barr virus infection vlg05170   Human immunodeficiency virus 1 infection vlg05171   Coronavirus disease - COVID-19 vlg05200   Pathways in cancer vlg05320   Autoimmune thyroid disease vlg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121495364    04151 PI3K-Akt signaling pathway     121495364   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121495364  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121495364  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121495364    04621 NOD-like receptor signaling pathway     121495364    04622 RIG-I-like receptor signaling pathway     121495364    04623 Cytosolic DNA-sensing pathway     121495364    04650 Natural killer cell mediated cytotoxicity     121495364  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121495364   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121495364    05161 Hepatitis B     121495364    05160 Hepatitis C     121495364    05171 Coronavirus disease - COVID-19     121495364    05164 Influenza A     121495364    05162 Measles     121495364    05168 Herpes simplex virus 1 infection     121495364    05163 Human cytomegalovirus infection     121495364    05167 Kaposi sarcoma-associated herpesvirus infection     121495364    05169 Epstein-Barr virus infection     121495364    05165 Human papillomavirus infection     121495364   09171 Infectious disease: bacterial    05152 Tuberculosis     121495364   09163 Immune disease    05320 Autoimmune thyroid disease     121495364   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121495364   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121495364  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121495364 Cytokines and neuropeptides [BR:vlg04052]  Cytokines   Interferons    121495364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  121495364 NCBI-ProteinID:  XP_041618665 LinkDB All DBs Position 7:complement(91853658..91854631) Genome browser AA seq 228 aa AA seqDB search MENASVAYLSPTHEGRCSEKLEPRFPHLPSAARPTAPAGSPMALPCSFSLALVLLSCHSL CCLACDLPDAHGLRNWRVLTLLGQMRRLSAGSCDHDTNDFAFPKELFDGQRLQEAQALSV VHVMTQKVFHLFCPDTSSAPWNMTLLEELCSGLSQQLDDLEACPLQEAGLAETPLMHEDS TLRSYFQRISLYLQDKNHSPCAWEMVRAEIGRSFFSSTILQERIRRRK NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggaaaacgcgtctgttgcctacttaagccccacacacgagggaagatgctcagagaag ctggagccgcggttcccacacttgcccagcgcagccaggcccacagcccctgcaggatcc ccgatggccctgccctgctccttctcgctggccctggtgctgctcagctgccactccctg tgctgtctggcttgcgacctgcccgacgcccacggcctgcgcaactggagggtcctgacg ctcctgggacagatgaggagactctccgccggctcttgtgaccacgacaccaatgacttt gccttccccaaggagctgtttgatggccagcggctccaggaggcgcaggccctctctgtg gtccacgtgatgacccagaaggtcttccacctcttctgcccggacacgtcctccgctcct tggaacatgactctcctggaggaactgtgctcggggctctcgcagcagctggatgacctg gaggcctgtcccctgcaggaggcggggctggccgagacccccctcatgcatgaggactcc accctgaggtcctacttccaaaggatctccctctacctgcaagacaagaaccacagcccg tgtgcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttg caagaaagaatcaggaggaggaaatga

DBGET integrated database retrieval system