Vulpes lagopus (Arctic fox): 121495498 Help Entry 121495498         CDS       T07435                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04810   Regulation of actin cytoskeleton vlg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vlg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121495498 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121495498 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  121495498 NCBI-ProteinID:  XP_041618956 LinkDB All DBs Position 7:49982071..49993045 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggccaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggaa tacattgaggtcatcaccagcagcatcaagaagatcgcggactttctcaactcattcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagccctcgagcggaga atagagtacattgaagcacgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system