Vulpes lagopus (Arctic fox): 121495581 Help Entry 121495581         CDS       T07435                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04382   Cornified envelope formation vlg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121495581  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121495581  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121495581 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of microglial cells    121495581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 TMP_3 Motif Other DBs NCBI-GeneID:  121495581 NCBI-ProteinID:  XP_041619215 LinkDB All DBs Position 7:98411305..98411879 Genome browser AA seq 112 aa AA seqDB search MPAAPHAKVSTDLTKMPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLED QKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgcccgccgcgcctcacgccaaggtttcaacagacctcaccaagatgccatctcaaatg gaacatgccatggaaaccatgatgttcacgtttcacaagtttgctggggataaaggatac ttgacaaaggaagacctgagagtactcatggaaaaagaattcccaggatttttggaagat caaaaagaccctctggccgtggacaaaataatgaaggacctcgaccagtgccgagatggc aaagtgggcttccagagcttcttttcactaattgctgggctcaccattgcatgcaatgac tattttgtaatacacatgaagcagaagggcaagaaatag

DBGET integrated database retrieval system