Vulpes lagopus (Arctic fox): 121496827 Help Entry 121496827         CDS       T07435                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04382   Cornified envelope formation vlg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121496827  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121496827  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121496827 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of microglial cells    121496827 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  121496827 NCBI-ProteinID:  XP_041621498 LinkDB All DBs Position 1:complement(36720662..36721220) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggatacttgacaaaggaagacctgagagtactcatggaaaaagaattccca ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctcgac cagtgccgagatggcaaagtgggcttccagagcttcttttcactaattgctgggctcacc attgcatgcaatgactattttgtaatacacatgaagcagaagggcaagaaatag

DBGET integrated database retrieval system