Vulpes lagopus (Arctic fox): 121497865 Help Entry 121497865         CDS       T07435                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg00480   Glutathione metabolism vlg00980   Metabolism of xenobiotics by cytochrome P450 vlg00982   Drug metabolism - cytochrome P450 vlg00983   Drug metabolism - other enzymes vlg01100   Metabolic pathways vlg01524   Platinum drug resistance vlg05200   Pathways in cancer vlg05204   Chemical carcinogenesis - DNA adducts vlg05215   Prostate cancer vlg05225   Hepatocellular carcinoma vlg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     121497865   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     121497865    00982 Drug metabolism - cytochrome P450     121497865    00983 Drug metabolism - other enzymes     121497865  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121497865    05204 Chemical carcinogenesis - DNA adducts     121497865   09162 Cancer: specific types    05225 Hepatocellular carcinoma     121497865    05215 Prostate cancer     121497865   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121497865   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121497865  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:vlg02000]     121497865 Enzymes [BR:vlg01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      121497865 Transporters [BR:vlg02000]  Other transporters   Pores ion channels [TC:1]    121497865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_2 Motif Other DBs NCBI-GeneID:  121497865 NCBI-ProteinID:  XP_041623533 LinkDB All DBs Position 8:6108842..6109562 Genome browser AA seq 210 aa AA seqDB search MPPYTIIYFPVRGRCEAMYMLLVDQGQSWKEEVVTMETWMKGSLKASCLYGQLPKFWDGD LTLYQSNAILQHLGHSLGLYRKDLQEAAALLDVVNDGVEDLRCKYILLIYTNYEAGKEEY VKAHTYLKPFETLLSQNEGGQAFTVGNQISFADYNLLDLLLIHQVLAPSCLDSLPLLSAY VARLRPRPKLKVFLASPEHVNRPINDNRKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccaccctacaccatcatctacttccctgttcgagggcgctgcgaggccatgtacatg ctgctggttgaccagggccagagctggaaggaggaggtggtgaccatggagacctggatg aagggctcactcaaggcctcctgtctgtacgggcagctccccaagttctgggacggagac ctcaccctgtaccagtccaatgccatcctacaacacctgggccactccctcgggctctat aggaaggacctgcaggaggcggcggccttgctggatgtagtgaatgatggtgtggaggat ctccgctgcaaatacatcctcctcatctacactaactacgaggcaggaaaggaggagtat gtgaaggcacacacatacctgaagccttttgaaacgctgctatcccagaatgaggggggc caggccttcaccgtgggcaaccagatctccttcgcagactataacctgttggacttgctg ctgattcaccaggtcctggcccccagctgcctggactccctccccctgctctcggcctat gtggcacgcctcaggcccagacccaagctcaaggtgttcctggcgtcccccgagcacgtg aaccgccccatcaatgacaacaggaagcagtga

DBGET integrated database retrieval system