Vulpes lagopus (Arctic fox): 121497993 Help Entry 121497993         CDS       T07435                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04060   Cytokine-cytokine receptor interaction vlg04061   Viral protein interaction with cytokine and cytokine receptor vlg04062   Chemokine signaling pathway vlg04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121497993 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     121497993 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121497993 (CCL22)    04062 Chemokine signaling pathway     121497993 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121497993 (CCL22) Cytokines and neuropeptides [BR:vlg04052]  Cytokines   Chemokines    121497993 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  121497993 NCBI-ProteinID:  XP_041623834 LinkDB All DBs Position 8:complement(108082052..108087155) Genome browser AA seq 93 aa AA seqDB search MASLKTPLLAALVFLVLTLQATEAGPYGANVEDSICCRDYIRHPLPLRMLKYFYWTSDSC RRPGVVFLTVKDREICADPRLPWVKKLLQKLDP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagactccgctcctggctgcccttgtcttccttgttctgacacttcaa gcgactgaggcaggtccttatggtgccaacgtggaagacagtatctgctgccgggactac atccgtcaccctctgcccctgcgtatgctgaagtatttctactggacttcagactcctgc cggaggcctggcgtggtcttcctaactgtcaaggatcgggagatctgtgctgaccccaga ttgccctgggtgaagaagcttctccagaagctggacccatga

DBGET integrated database retrieval system