KEGG   Vulpes lagopus (Arctic fox): 121498145
Entry
121498145         CDS       T07435                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
vlg  Vulpes lagopus (Arctic fox)
Pathway
vlg04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:vlg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    121498145 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:vlg04050]
    121498145 (TNFRSF8)
   04090 CD molecules [BR:vlg04090]
    121498145 (TNFRSF8)
Cytokine receptors [BR:vlg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   121498145 (TNFRSF8)
CD molecules [BR:vlg04090]
 Proteins
  121498145 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 121498145
NCBI-ProteinID: XP_041624119
LinkDB
Position
8:complement(133364843..133408096)
AA seq 493 aa
MFCATSATNSCARCIFHSICATGMVVRFQGTAERDTVCELPAPATSPDCSTSPEACQAPT
SSAPPQARPLLTSSASSRARTTLLGGGASLTPEDDPKVARATASPSAQKPRPDLGLTAQQ
LCPQGSSDCGKQCEPDYYLDRDGRCKACVSCSGDDLVEKTPCTWNSSRVCECRPGMFCAT
SATNSCARCITHPICPPGMVTKPQGTAERAAPHELPAPEAHPACSINPDDSTAPTSTTAS
LVPTVDPQPSKEHGGPITHAWGDPSISTSTPVSFSSTGKPVLVSGPVLFWMVVILVVVLG
SVSFVLCHRRACRKWIQQKLHLCYPVQTFRPKLEPADSRSRRNLMLEKSISVVESGLEEV
GLMSSPAVDPGPDGAACLESVRLLEASPAGGPPSPRDLPEPRLTSEHTNNRIEKIYIMKA
DTVIVGTVTTEGPEGRSLVGPAGPEFEEDLEVDHAPHFPEQETEPPLGSCGDVMFSVEEE
GKEAPLPMTVSEK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgttctgtgccacatcagccaccaacagctgtgcccgctgcatcttccactccatctgc
gcgacagggatggttgtcaggttccagggcacggcagagagggacactgtctgtgagctg
cctgccccagcgaccagccctgactgcagcaccagccccgaagcctgccaggcccccacc
agcagcgcccccccgcaggccaggcctctcctgacttcctcagcaagctccagggccagg
accacgcttcttggagggggtgcttccctcaccccggaagatgatcccaaagtggcaagg
gccaccgcctctccctctgcgcagaagccccgtccagacctagggctgaccgcgcagcag
ctgtgcccacaggggtcctccgactgcgggaagcagtgtgagcccgactactacctggac
cgggacggccgctgcaaggcctgtgtgagctgctctggagatgacctggtggagaagact
ccttgtacatggaactcctctcgcgtctgtgaatgtcggcctggcatgttctgtgccacc
tcagccaccaactcctgtgctcgctgtatcacccaccccatctgcccaccagggatggtc
accaaaccccagggtacagctgagagggctgctccccatgagctgcctgcccctgaggcc
caccctgcgtgcagcatcaacccagacgacagcacggcgcccaccagcaccactgcctct
ctggtccccacggtagacccccagcccagtaaggagcatggggggcccatcacccacgcc
tggggagacccctccatatcaactagcactcctgtctcattctcctccaccgggaagccc
gttctggtttcagggcccgtgctcttctggatggtcgtgatcctggtggtggtcttgggc
tccgtctccttcgtcctgtgccaccggagggcctgcaggaagtggattcagcagaagctg
cacctgtgctaccctgtccagaccttccggcccaagctggagcctgcggattccaggtcc
aggaggaacctgatgctggagaagagtatatcggtggtcgagtcgggcctggaagaggtg
ggcttaatgagctccccggctgtggaccccggccccgacggggcggcctgcctggagagc
gtgcggctgctggaagccagcccggccggcggtcccccgtcccccagggaccttcccgag
ccccggctgacctcggagcacaccaacaacaggatcgagaagatctacatcatgaaggct
gacaccgtgattgtggggaccgtcacgaccgaggggcctgagggccgcagcctggtgggg
ccggcagggcctgaattcgaggaggatctggaagtggaccatgccccccacttcccggag
caggagacagaaccacctctgggcagctgtggggacgtcatgttctcagtagaagaggaa
ggaaaagaggcccccttgcccatgaccgtctctgagaaatga

DBGET integrated database retrieval system