Vulpes lagopus (Arctic fox): 121500111 Help Entry 121500111         CDS       T07435                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04613   Neutrophil extracellular trap formation vlg05034   Alcoholism vlg05203   Viral carcinogenesis vlg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121500111  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     121500111   09163 Immune disease    05322 Systemic lupus erythematosus     121500111   09165 Substance dependence    05034 Alcoholism     121500111  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vlg03036]     121500111   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121500111 Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121500111 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121500111 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  121500111 NCBI-ProteinID:  XP_041627506 LinkDB All DBs Position 10:1107021..1107401 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcccgccaagtccgcgccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system