Vulpes lagopus (Arctic fox): 121500118 Help Entry 121500118         CDS       T07435                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04613   Neutrophil extracellular trap formation vlg05034   Alcoholism vlg05203   Viral carcinogenesis vlg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vlg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121500118  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     121500118   09163 Immune disease    05322 Systemic lupus erythematosus     121500118   09165 Substance dependence    05034 Alcoholism     121500118  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vlg03036]     121500118 Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121500118 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  121500118 NCBI-ProteinID:  XP_041627515 LinkDB All DBs Position 10:complement(1567000..1567349) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaaggggctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctatggc ttcgggggttga

DBGET integrated database retrieval system