Vulpes lagopus (Arctic fox): 121500568 Help Entry 121500568         CDS       T07435                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism vlg  Vulpes lagopus (Arctic fox) Brite KEGG Orthology (KO) [BR:vlg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vlg03041]     121500568   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121500568 Spliceosome [BR:vlg03041]  Complex B   Other components    Complex B specific factors     121500568 Cytokines and neuropeptides [BR:vlg04052]  Neuropeptides   Unclassified    121500568 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  121500568 NCBI-ProteinID:  XP_041628310 LinkDB All DBs Position 10:complement(65966870..65967332) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIRDLKKLIAAQTGTGWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggttgtttgcaacgaccgtctagggaagaaggtccgcgttaagtgcaacact gatgacaccatcagggaccttaagaagctgatcgcagcccaaactggcaccggttggaac aagatcgtcctgaagaagtggtacacgattttcaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system