Vulpes lagopus (Arctic fox): 121500599 Help Entry 121500599         CDS       T07435                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04014   Ras signaling pathway vlg04015   Rap1 signaling pathway vlg04020   Calcium signaling pathway vlg04022   cGMP-PKG signaling pathway vlg04024   cAMP signaling pathway vlg04070   Phosphatidylinositol signaling system vlg04114   Oocyte meiosis vlg04218   Cellular senescence vlg04261   Adrenergic signaling in cardiomyocytes vlg04270   Vascular smooth muscle contraction vlg04371   Apelin signaling pathway vlg04625   C-type lectin receptor signaling pathway vlg04713   Circadian entrainment vlg04720   Long-term potentiation vlg04722   Neurotrophin signaling pathway vlg04728   Dopaminergic synapse vlg04740   Olfactory transduction vlg04744   Phototransduction vlg04750   Inflammatory mediator regulation of TRP channels vlg04910   Insulin signaling pathway vlg04912   GnRH signaling pathway vlg04915   Estrogen signaling pathway vlg04916   Melanogenesis vlg04921   Oxytocin signaling pathway vlg04922   Glucagon signaling pathway vlg04924   Renin secretion vlg04925   Aldosterone synthesis and secretion vlg04970   Salivary secretion vlg04971   Gastric acid secretion vlg05010   Alzheimer disease vlg05012   Parkinson disease vlg05022   Pathways of neurodegeneration - multiple diseases vlg05031   Amphetamine addiction vlg05034   Alcoholism vlg05133   Pertussis vlg05152   Tuberculosis vlg05163   Human cytomegalovirus infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05170   Human immunodeficiency virus 1 infection vlg05200   Pathways in cancer vlg05214   Glioma vlg05417   Lipid and atherosclerosis vlg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121500599 (CALML6)    04015 Rap1 signaling pathway     121500599 (CALML6)    04070 Phosphatidylinositol signaling system     121500599 (CALML6)    04024 cAMP signaling pathway     121500599 (CALML6)    04022 cGMP-PKG signaling pathway     121500599 (CALML6)  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     121500599 (CALML6)    04915 Estrogen signaling pathway     121500599 (CALML6)    04921 Oxytocin signaling pathway     121500599 (CALML6)    04924 Renin secretion     121500599 (CALML6)    04925 Aldosterone synthesis and secretion     121500599 (CALML6)   09154 Digestive system    04970 Salivary secretion     121500599 (CALML6)    04971 Gastric acid secretion     121500599 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     121500599 (CALML6)    04720 Long-term potentiation     121500599 (CALML6)    04722 Neurotrophin signaling pathway     121500599 (CALML6)   09157 Sensory system    04740 Olfactory transduction     121500599 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     121500599 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     121500599 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121500599 (CALML6)   09162 Cancer: specific types    05214 Glioma     121500599 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121500599 (CALML6)    05163 Human cytomegalovirus infection     121500599 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     121500599 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     121500599 (CALML6)    05152 Tuberculosis     121500599 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     121500599 (CALML6)    05012 Parkinson disease     121500599 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     121500599 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     121500599 (CALML6)    05034 Alcoholism     121500599 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121500599 (CALML6)    05418 Fluid shear stress and atherosclerosis     121500599 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vlg01009]     121500599 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121500599 (CALML6)    03036 Chromosome and associated proteins [BR:vlg03036]     121500599 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121500599 (CALML6) Protein phosphatases and associated proteins [BR:vlg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121500599 (CALML6) Membrane trafficking [BR:vlg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121500599 (CALML6) Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121500599 (CALML6) Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121500599 (CALML6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  121500599 NCBI-ProteinID:  XP_041628389 LinkDB All DBs Position 10:83377924..83379652 Genome browser AA seq 156 aa AA seqDB search MTERLTAEQIKEYKGVFEMFDEEGNGEVKTGELERLMSLLGINPTKSELASMAKDVDRDN KGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKEGKGYIDWDTLKYVLMNAGEPLNE VEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgacggagcgcctgacagccgagcagatcaaggagtacaagggggtctttgagatgttc gacgaggaaggcaacggggaggtgaagactggtgagctggagcggctcatgagcctgctg ggcatcaaccccaccaagagtgagctggcctccatggccaaggacgtggacagagacaac aaaggattcttcaactgtgacagcttcctggccctgatggggatttactgggagaaggcc cagaaccaggagggcgagctgagggcagcgttccgtgtcttcgacaaggaaggcaagggc tacatcgactgggacacgctcaagtacgtgctcatgaatgcaggggagcccctcaatgag gtagaggccgagcagatgatgaaggaggctgacaaggatggtgatgggaccattgactac gaggagtttgtggccatgatgaccggagagtccttcaagctggtccaatag

DBGET integrated database retrieval system