KEGG   Vulpes lagopus (Arctic fox): 121500700
Entry
121500700         CDS       T07435                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
vlg  Vulpes lagopus (Arctic fox)
Pathway
vlg03050  Proteasome
vlg05010  Alzheimer disease
vlg05012  Parkinson disease
vlg05014  Amyotrophic lateral sclerosis
vlg05016  Huntington disease
vlg05017  Spinocerebellar ataxia
vlg05020  Prion disease
vlg05022  Pathways of neurodegeneration - multiple diseases
vlg05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:vlg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    121500700 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    121500700 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    121500700 (PSMD7)
   05012 Parkinson disease
    121500700 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    121500700 (PSMD7)
   05016 Huntington disease
    121500700 (PSMD7)
   05017 Spinocerebellar ataxia
    121500700 (PSMD7)
   05020 Prion disease
    121500700 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    121500700 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:vlg03051]
    121500700 (PSMD7)
Proteasome [BR:vlg03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     121500700 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N
Other DBs
NCBI-GeneID: 121500700
NCBI-ProteinID: XP_041628595
LinkDB
Position
10:106634988..106643546
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKEKEKEKGDSKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtcgttcaccccctggtgctgctcagtgtggtg
gatcacttcaaccgaataggcaaggttggaaaccagaagcgcgttgtcggtgtgcttttg
gggtcatggcaaaagaaggtactcgacgtatccaacagttttgcagtcccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccattaacgaactcatgaaaagatactgccctaactcagta
ctggtcatcattgatgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagtccatgatgatggaacgccaacctcaaaaacatttgagcatgtgaccagt
gagattggagcggaggaagccgaggaagttggagtcgagcacttgttacgagacatcaaa
gacactacggtgggcactctttcacagaggattacaaaccaggtccatggtttgaaggga
ctaaactccaagcttctggacatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccatcagatcatctaccagctacaggatgtcttcaacctgctgccggacgtc
agcctccaggagtttgtcaaggccttttacctgaagaccaacgaccagatggtagtggta
tacttggcctcactgatccgttctgtggtcgccctgcacaacctcatcaacaacaagatc
gccaaccgcgatgcagagaagaaagaagggcaggaaaaagaagagagcaaaaaggataga
aaagatgacaaagagaaagagaaggagaaggaaaagggtgacagcaagaaagaagagaaa
aaagagaaaaaataa

DBGET integrated database retrieval system