Vulpes lagopus (Arctic fox): 121501375 Help Entry 121501375         CDS       T07435                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04010   MAPK signaling pathway vlg04014   Ras signaling pathway vlg04015   Rap1 signaling pathway vlg04020   Calcium signaling pathway vlg04151   PI3K-Akt signaling pathway vlg04810   Regulation of actin cytoskeleton vlg05200   Pathways in cancer vlg05207   Chemical carcinogenesis - receptor activation vlg05218   Melanoma vlg05224   Breast cancer vlg05226   Gastric cancer Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121501375 (FGF4)    04014 Ras signaling pathway     121501375 (FGF4)    04015 Rap1 signaling pathway     121501375 (FGF4)    04020 Calcium signaling pathway     121501375 (FGF4)    04151 PI3K-Akt signaling pathway     121501375 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121501375 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121501375 (FGF4)    05207 Chemical carcinogenesis - receptor activation     121501375 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     121501375 (FGF4)    05218 Melanoma     121501375 (FGF4)    05224 Breast cancer     121501375 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121501375 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:vlg00536]     121501375 (FGF4) Cytokines and neuropeptides [BR:vlg04052]  Cytokines   Growth factors (RTK binding)    121501375 (FGF4) Glycosaminoglycan binding proteins [BR:vlg00536]  Heparan sulfate / Heparin   Growth factors/receptors    121501375 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  121501375 NCBI-ProteinID:  XP_041629295 LinkDB All DBs Position 11:72027238..72029018 Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLPAVLLAVLAPWAGRGGAAAPTAPNGTLGAELERRWESLVVRSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTEECKFKEILLPNNYNAYECYRYPGMFIA LSKNGKTKKGSRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcggcgctgctcccggcggtcctgttggcggtgctg gcgccctgggccggccgcgggggcgccgccgcccccaccgcccccaacggcacgctgggc gccgagctggagcgccgctgggagagcctggtggtgcgctcgctggcgcgcctgccggtg gccgcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctcctgggcatc aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggtgctcccc gacggccgcatcggcggcgtgcacgcggacacgagcgacagcctgctggagctctcgccg gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc agcaagggcaagctgtacggctcgcccttcttcaccgaggagtgcaagttcaaagagatc ctgctccccaacaactacaatgcctacgagtgctacaggtacccaggcatgttcattgcc ctgagcaagaacgggaagaccaagaaagggagccgagtgtcccccaccatgaaggtcacc cacttcctccccaggctgtga

DBGET integrated database retrieval system