Micromonospora maris: VAB18032_18165 Help Entry VAB18032_18165    CDS       T01471                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism vma  Micromonospora maris Pathway vma01056   Biosynthesis of type II polyketide backbone vma01100   Metabolic pathways vma01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vma00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     VAB18032_18165    00253 Tetracycline biosynthesis     VAB18032_18165  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:vma01004]     VAB18032_18165    01008 Polyketide biosynthesis proteins [BR:vma01008]     VAB18032_18165 Lipid biosynthesis proteins [BR:vma01004]  Polyketide synthase   Component type    VAB18032_18165 Polyketide biosynthesis proteins [BR:vma01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      VAB18032_18165     Nonaketide PKS      VAB18032_18165     Decaketide PKS      VAB18032_18165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEB44735 LinkDB All DBs Position complement(2984754..2985011) Genome browser AA seq 85 aa AA seqDB search MPELTLADLTRILRAAGGEDDPETLQGDILDVPFTDLGYDSLAMLETVSRIEREFDLSLP DDLVPEMPTPRIALDTINSRLRAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccgaactgaccttggcggatctgacgcgaatcctgcgtgcggccggcggtgaggac gatcccgagacgctccagggtgacatcctcgacgtgcccttcaccgacctcggctacgac tcgctggcaatgttggagacggtgagccggatcgaacgtgagttcgacctctccctgccg gacgatctggtaccggagatgcccacaccccgcatcgcactggacaccatcaattcccgg ctgcgcgcggcggcctga

DBGET integrated database retrieval system