Vidua macroura (Pin-tailed whydah): 128804572 Help Entry 128804572         CDS       T11570                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04080   Neuroactive ligand-receptor interaction vmc04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:vmc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     128804572 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     128804572 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vmc04052]     128804572 (NPY) Cytokines and neuropeptides [BR:vmc04052]  Neuropeptides   GPCR binding    128804572 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 LURY1 Motif Other DBs NCBI-GeneID:  128804572 NCBI-ProteinID:  XP_053828415 LinkDB All DBs Position 1:32391702..32401659 Genome browser AA seq 97 aa AA seqDB search MQGTVRLWVSVLTFALSLLVCLGTLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPDTLISDLLLRESTENIPRSRFEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagggcaccgtgaggctgtgggtgtcggtgctgactttcgccctgtcgctgctggtc tgcctgggaacgctggcagaggcgtacccctccaaaccggacagccccggcgaggacgcc cccgcagaggacatggccagatactactcggcgctgaggcactacatcaacctcatcacc aggcagagatatggaaagagatcaagcccagatacactgatctcagacctcttgttgagg gaaagcacagaaaacattcctagatccaggtttgaagacccttcgatgtggtga

DBGET integrated database retrieval system