Vidua macroura (Pin-tailed whydah): 128804992 Help Entry 128804992         CDS       T11570                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04145   Phagocytosis vmc04814   Motor proteins vmc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vmc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     128804992 (DYNLT1)   09142 Cell motility    04814 Motor proteins     128804992 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128804992 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vmc03037]     128804992 (DYNLT1)    04812 Cytoskeleton proteins [BR:vmc04812]     128804992 (DYNLT1) Cilium and associated proteins [BR:vmc03037]  Motile cilia and associated proteins   Dynein arm    128804992 (DYNLT1) Cytoskeleton proteins [BR:vmc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      128804992 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  128804992 NCBI-ProteinID:  XP_053829364 LinkDB All DBs Position 3:54077294..54082404 Genome browser AA seq 113 aa AA seqDB search MDEFQTGEEASFLVDEVSSIIKEAIEGAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagttccagacgggagaggaggcttcctttcttgttgatgaagtcagcagcatt attaaagaggccatagagggtgctatcggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagcgtggtggaacaaaccctgagccagctcacaaagctggggaagccc ttcaagtacatcgtgacctgtgtgattatgcaaaagaatggcgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag accatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system