Vidua macroura (Pin-tailed whydah): 128806635 Help Entry 128806635         CDS       T11570                                  Name (RefSeq) interleukin-8 isoform X1   KO K10030   interleukin 8 Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04060   Cytokine-cytokine receptor interaction vmc04218   Cellular senescence vmc04620   Toll-like receptor signaling pathway vmc04621   NOD-like receptor signaling pathway vmc04622   RIG-I-like receptor signaling pathway vmc05132   Salmonella infection vmc05164   Influenza A Brite KEGG Orthology (KO) [BR:vmc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128806635  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     128806635  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128806635    04621 NOD-like receptor signaling pathway     128806635    04622 RIG-I-like receptor signaling pathway     128806635  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     128806635   09171 Infectious disease: bacterial    05132 Salmonella infection     128806635  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vmc04052]     128806635    00536 Glycosaminoglycan binding proteins [BR:vmc00536]     128806635 Cytokines and neuropeptides [BR:vmc04052]  Cytokines   Chemokines    128806635 Glycosaminoglycan binding proteins [BR:vmc00536]  Heparan sulfate / Heparin   Chemokines    128806635 SSDB OrthologParalogGFIT Motif Pfam:  IL8 bPH_6 Motif Other DBs NCBI-GeneID:  128806635 NCBI-ProteinID:  XP_053832329 LinkDB All DBs Position 4:complement(3338129..3341311) Genome browser AA seq 103 aa AA seqDB search MNGKLVAILALFLISAAVSQGRTLARMGTELRCQCIATHSRLIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKAILARAQHNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaactcgtagctatcctggctcttttcctgatctcagcagctgtgtctcaa ggtaggaccctggcaaggatgggaaccgagctccggtgccagtgcatagccactcattcc aggttaattcccccgaagtccattcaagatgtgaagctgacacagagcggcccccactgc aagaatgttgaagtcatagctactctgaaggatggcagagaggtgtgcttggagcccact gctccctgggtacagctgattgtaaaggcaattttggccagggctcaacacaattctgat tctcctctctaa

DBGET integrated database retrieval system