Vidua macroura (Pin-tailed whydah): 128809469 Help Entry 128809469         CDS       T11570                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04010   MAPK signaling pathway vmc04012   ErbB signaling pathway vmc04068   FoxO signaling pathway vmc04137   Mitophagy - animal vmc04140   Autophagy - animal vmc04144   Endocytosis vmc04150   mTOR signaling pathway vmc04210   Apoptosis vmc04218   Cellular senescence vmc04370   VEGF signaling pathway vmc04371   Apelin signaling pathway vmc04510   Focal adhesion vmc04519   Cadherin signaling vmc04540   Gap junction vmc04625   C-type lectin receptor signaling pathway vmc04810   Regulation of actin cytoskeleton vmc04910   Insulin signaling pathway vmc04912   GnRH signaling pathway vmc04916   Melanogenesis vmc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vmc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128809469 (HRAS)    04012 ErbB signaling pathway     128809469 (HRAS)    04370 VEGF signaling pathway     128809469 (HRAS)    04371 Apelin signaling pathway     128809469 (HRAS)    04068 FoxO signaling pathway     128809469 (HRAS)    04150 mTOR signaling pathway     128809469 (HRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     128809469 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128809469 (HRAS)    04140 Autophagy - animal     128809469 (HRAS)    04137 Mitophagy - animal     128809469 (HRAS)   09143 Cell growth and death    04210 Apoptosis     128809469 (HRAS)    04218 Cellular senescence     128809469 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128809469 (HRAS)    04540 Gap junction     128809469 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128809469 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128809469 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     128809469 (HRAS)    04912 GnRH signaling pathway     128809469 (HRAS)    04916 Melanogenesis     128809469 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128809469 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vmc04131]     128809469 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vmc04147]     128809469 (HRAS)    04031 GTP-binding proteins [BR:vmc04031]     128809469 (HRAS) Membrane trafficking [BR:vmc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128809469 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128809469 (HRAS) Exosome [BR:vmc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    128809469 (HRAS)   Exosomal proteins of colorectal cancer cells    128809469 (HRAS) GTP-binding proteins [BR:vmc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128809469 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  128809469 NCBI-ProteinID:  XP_053837463 UniProt:  A0A852E1H8 LinkDB All DBs Position 6:47826926..47866851 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgaca atacaactcattcagaaccattttgttgatgaatatgaccccacgatagaggattcctac agaaagcaagtagtcatcgatggagagacctgtttgttagacatcttggacactgcaggg caggaggagtacagtgccatgagagaccagtacatgagaacaggggaaggattcctgtgt gtctttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtggggaataaatgtgacctc cctgcgcggacagtggagacccggcaagcgcaggacctggcccggagctacgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaggatgccttctacaccttggtg cgggagatccggcagcataagctgcgcaagctgaatcctccggatgagagcggccctggc tgcatgaactgtaaatgcgtggtatcgtga

DBGET integrated database retrieval system