Vidua macroura (Pin-tailed whydah): 128817791 Help Entry 128817791         CDS       T11570                                  Symbol URM1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:vmc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     128817791 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:vmc03016]     128817791 (URM1)    04121 Ubiquitin system [BR:vmc04121]     128817791 (URM1) Transfer RNA biogenesis [BR:vmc03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     128817791 (URM1) Ubiquitin system [BR:vmc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    128817791 (URM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  128817791 NCBI-ProteinID:  XP_053852610 LinkDB All DBs Position 21:6023960..6042684 Genome browser AA seq 101 aa AA seqDB search MAAPVSLQVEFGGGAELLFDGVKKHQVTLPCQPEPWDIRNLLKWIKQNLLKERPELFLQG ESVRPGILVLINEADWELMGELDYKLQDQDNVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggcgcccgtgtcgctgcaggtggagttcggaggtggtgcagaactcttattcgat ggtgtcaaaaagcatcaggtgactttgccctgtcaaccagagccttgggatatcagaaac ctgctcaagtggatcaaacagaatctgttgaaagagcgaccagagttatttttgcaaggg gaatctgtgaggccaggaattttggtgctcatcaacgaggcagactgggaactaatgggt gagctggattataaactccaggaccaggataatgtgcttttcatctcaacactgcatggc gggtga

DBGET integrated database retrieval system