Vidua macroura (Pin-tailed whydah): 128818685 Help Entry 128818685         CDS       T11570                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04010   MAPK signaling pathway vmc04012   ErbB signaling pathway vmc04068   FoxO signaling pathway vmc04137   Mitophagy - animal vmc04140   Autophagy - animal vmc04150   mTOR signaling pathway vmc04210   Apoptosis vmc04218   Cellular senescence vmc04370   VEGF signaling pathway vmc04371   Apelin signaling pathway vmc04540   Gap junction vmc04625   C-type lectin receptor signaling pathway vmc04810   Regulation of actin cytoskeleton vmc04910   Insulin signaling pathway vmc04912   GnRH signaling pathway vmc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:vmc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128818685 (NRAS)    04012 ErbB signaling pathway     128818685 (NRAS)    04370 VEGF signaling pathway     128818685 (NRAS)    04371 Apelin signaling pathway     128818685 (NRAS)    04068 FoxO signaling pathway     128818685 (NRAS)    04150 mTOR signaling pathway     128818685 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128818685 (NRAS)    04137 Mitophagy - animal     128818685 (NRAS)   09143 Cell growth and death    04210 Apoptosis     128818685 (NRAS)    04218 Cellular senescence     128818685 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     128818685 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128818685 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128818685 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     128818685 (NRAS)    04912 GnRH signaling pathway     128818685 (NRAS)    04916 Melanogenesis     128818685 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vmc04131]     128818685 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vmc04147]     128818685 (NRAS)    04031 GTP-binding proteins [BR:vmc04031]     128818685 (NRAS) Membrane trafficking [BR:vmc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128818685 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128818685 (NRAS) Exosome [BR:vmc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128818685 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    128818685 (NRAS)   Exosomal proteins of breast cancer cells    128818685 (NRAS)   Exosomal proteins of colorectal cancer cells    128818685 (NRAS) GTP-binding proteins [BR:vmc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128818685 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  128818685 NCBI-ProteinID:  XP_053854210 LinkDB All DBs Position 24:3617288..3623498 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtcgtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtgatcgatggcgagacgtgcctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgc gtcttcgccatcaacaacagcaaatccttcgccgacatcaacctctacagagaacagatc aagagagtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgatctg cccacgagaacagtggacacaaaacaggcccaagaactggcaaaaagctacggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agggagatccggcagtaccggatgaagaagctcaacagcagcgaggatgggaaccagggc tgcatgggattgtcctgccttgtcatgtga

DBGET integrated database retrieval system