Vulcanisaeta moutnovskia: VMUT_0716 Help Entry VMUT_0716         CDS       T01440                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism vmo  Vulcanisaeta moutnovskia Pathway vmo03010   Ribosome Brite KEGG Orthology (KO) [BR:vmo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     VMUT_0716   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     VMUT_0716  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:vmo03011]     VMUT_0716    04121 Ubiquitin system [BR:vmo04121]     VMUT_0716   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vmo04147]     VMUT_0716 Ribosome [BR:vmo03011]  Ribosomal proteins   Eukaryotes    Small subunit     VMUT_0716   Archaea     VMUT_0716 Ubiquitin system [BR:vmo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    VMUT_0716 Exosome [BR:vmo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VMUT_0716   Exosomal proteins of colorectal cancer cells    VMUT_0716 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_Ribbon_TF Cas12f1-like_TNB YhfH ADK_lid Zn_ribbon_3 Zn_ribbon_PriA IBR_1 Ribosomal_L37e Zn_ribbon_Nudix Zn_ribbon_RPB9 RUBY_RBDX Lar_restr_allev Zn_ribbon_NUD TackOD1 DZR Zn_ribbon_ISL3 Motif Other DBs NCBI-ProteinID:  ADY00927 UniProt:  F0QW03 LinkDB All DBs Position complement(688526..688720) Genome browser AA seq 64 aa AA seqDB search MTVPKEIKARAHTWYEVDYEKGTIKFLRRICPRCGSVMAYHKVPVPRWTCGKCGYTIFEQ ARAR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgactgtgccaaaggagattaaggcaagggcgcacacgtggtatgaggttgattatgag aagggtaccataaagtttcttaggaggatttgtccaaggtgcggttcagtaatggcttat cacaaggtcccagtgccgagatggacctgcggtaaatgtggatacacaatattcgagcaa gccagggctcgataa

DBGET integrated database retrieval system