Vibrio metoecus: QYQ96_11230 Help Entry QYQ96_11230       CDS       T09673                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism vmt  Vibrio metoecus Brite KEGG Orthology (KO) [BR:vmt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vmt03036]     QYQ96_11230 (ftsB) Chromosome and associated proteins [BR:vmt03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     QYQ96_11230 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC MENTAL Motif Other DBs NCBI-ProteinID:  WKY92821 LinkDB All DBs Position 1:complement(2472545..2472829) Genome browser AA seq 94 aa AA seqDB search MRVFALALSLLLVWLLYTLMWGKNGVMDFRAVNAEIEVQQQVNANLHLRNQEMFAEIDDL RQGLDAIEERARNELGMVKDGETFYRIIGEESRQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcgagtatttgctttggccctaagcctactgttggtctggctgctttataccctgatg tgggggaaaaacggtgtgatggattttcgggctgtgaacgcagaaattgaggtgcaacag caggtgaatgctaacttgcacctacgtaaccaagaaatgtttgctgaaatcgatgatctg cgccaagggttagatgccattgaagaacgcgcccgtaatgaactcggtatggtcaaagat ggcgagactttttaccgcatcattggtgaggagtcgcgtcaatga

DBGET integrated database retrieval system