Vibrio natriegens: PN96_21780 Help Entry PN96_21780        CDS       T04636                                  Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism vna  Vibrio natriegens Brite KEGG Orthology (KO) [BR:vna00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:vna03110]     PN96_21780 Chaperones and folding catalysts [BR:vna03110]  Protein folding catalysts   Protein disulfide isomerase    PN96_21780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 KH_2 DUF6568 OST3_OST6 HyaE SutA-RBD Motif Other DBs NCBI-ProteinID:  ALR18914 LinkDB All DBs Position 2:complement(1573648..1573866) Genome browser AA seq 72 aa AA seqDB search MMTRVYQQTEKKLSGKAEFYDVNIDRHQELSERCRIRSIPTIVIYKNGKEVKRIDGVILS DDLQRQVEKYLK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgatgactcgggtctatcaacaaacagaaaagaaactcagtggcaaagctgaattttat gatgtgaatattgacagacatcaggaactctctgagcggtgtcgtatcagaagtatccca actatcgtcatctacaagaatggtaaagaagtaaaaagaatcgatggtgtgattcttagc gatgatcttcaacgtcaggttgaaaaatatctcaaataa

DBGET integrated database retrieval system