Vibrio nigripulchritudo: VIBNI_A0130 Help Entry VIBNI_A0130       CDS       T02871                                  Symbol ftsB Name (GenBank) Cell division protein ftsB   KO K05589   cell division protein FtsB Organism vni  Vibrio nigripulchritudo Brite KEGG Orthology (KO) [BR:vni00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vni03036]     VIBNI_A0130 (ftsB) Chromosome and associated proteins [BR:vni03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VIBNI_A0130 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Prefoldin_2 BAR_2 BLOC1_2 fvmX5 SHR3_chaperone LSU NUDE_C Motif Other DBs NCBI-ProteinID:  CCO56338 UniProt:  U4KC98 LinkDB All DBs Position 1:124640..124924 Genome browser AA seq 94 aa AA seqDB search MRIFAIVLVGLLIALQYAVWFSKNGELDLATTQRDIQIQEEVNEKLRQRNQEMYAEIDDL RQGLDAIEERARNELGLIKDDETFYRIIGDENRP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgagaatatttgccatagttttagttggattgttgattgcgttgcaatacgcggtctgg ttcagcaaaaacggagaactcgatttggcaaccactcagcgagatattcagatccaggaa gaagtaaatgagaagctgcgccagcgaaaccaagaaatgtacgctgaaatcgatgattta cgacaaggtcttgatgccatcgaagagcgggcacgtaatgagctcggactgatcaaagac gacgaaactttctaccgaatcatcggtgatgaaaacagaccctaa

DBGET integrated database retrieval system