Vibrio nigripulchritudo: VIBNI_B1748 Help Entry VIBNI_B1748       CDS       T02871                                  Name (GenBank) conserved hypothetical protein   KO K06078   murein lipoprotein Organism vni  Vibrio nigripulchritudo Brite KEGG Orthology (KO) [BR:vni00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01011 Peptidoglycan biosynthesis and degradation proteins [BR:vni01011]     VIBNI_B1748 Peptidoglycan biosynthesis and degradation proteins [BR:vni01011]  Peptidoglycan biosynthesis and degradation   Structural protein    VIBNI_B1748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alanine_zipper LPP DUF3138 ADIP FlxA CENP-F_leu_zip Hydro_N_hd SlyX STAT_alpha Syntaxin ZapB Not3 DUF16 DUF4407 DUF948 YlqD PepSY_TM FlaC_arch VPS51_Exo84_N Ax_dynein_light DASH_Spc19 FUT8_N_cat MbeD_MobD FtsL_2 DUF724 JIP_LZII BRI3BP HAUS-augmin3 UBR4 DivIC DUF2203 TMPIT Motif Other DBs NCBI-ProteinID:  CCO61476 UniProt:  U4KEB4 LinkDB All DBs Position 2:1789292..1789582 Genome browser AA seq 96 aa AA seqDB search MNNKLLLAAGISSVLFLAGCSGTPDTTSKKIDELTNQVQQLSQQVSSLQSSQEKASMKAE EAASAANGAKNAAMSAQQEASRANSRIDNIAQSYTK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaacaaattacttttagcagcgggtatttcttcagttctgtttttggccggttgc tctggtacgccagatacaacgtctaaaaaaattgatgagttgactaatcaggttcagcag ctcagtcaacaagtttcctcactgcaatcttctcaagaaaaagcaagcatgaaagcggaa gaagcagcttctgccgcaaacggtgcgaaaaacgcagcgatgtcagctcaacaggaagct tcgcgagcaaacagccgcatcgataacattgctcaatcttatacaaaatga

DBGET integrated database retrieval system