Vibrio neocaledonicus: D3H41_04565 Help Entry D3H41_04565       CDS       T06228                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vnl  Vibrio neocaledonicus Pathway vnl01100   Metabolic pathways vnl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vnl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D3H41_04565    00074 Mycolic acid biosynthesis     D3H41_04565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D3H41_04565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 SID Motif Other DBs NCBI-ProteinID:  QCO85403 LinkDB All DBs Position 1:complement(926305..926562) Genome browser AA seq 85 aa AA seqDB search MTDVNKDQVFEQVKDALVELFEIDAADIQSDAHLYQDLDLDSIDAVDLVVHLQNVTGKKI KPAEFSAVRTVDDVVNAVTELLKES NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactgatgtaaataaagatcaagtatttgaacaagttaaagatgcgcttgttgagctg ttcgaaattgacgcagccgacattcaatcagatgcgcacttataccaagatctcgatctt gatagcattgacgccgttgatttggtcgtacacctacagaatgtcactggcaaaaaaatc aagccagcagagtttagtgcagtaagaaccgttgacgatgtggttaacgctgtcactgag ttattgaaggaaagttaa

DBGET integrated database retrieval system