Vibrio neptunius: KW548_04255 Help Entry KW548_04255       CDS       T08906                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism vnp  Vibrio neptunius Brite KEGG Orthology (KO) [BR:vnp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vnp03036]     KW548_04255 (ftsB) Chromosome and associated proteins [BR:vnp03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KW548_04255 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC TolA_bind_tri Prefoldin_2 Motif Other DBs NCBI-ProteinID:  QXX07256 LinkDB All DBs Position 1:864683..864961 Genome browser AA seq 92 aa AA seqDB search MRIFALTLLLLLGWLQYTLWLGKNGISEFQSVKAEIEVQHQVNGNLQNRNDEMFAEIDDL RQGLDAIEERARHELGMVKEGETFYRIVGDDN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgaatttttgccctaactttactcttgttattaggctggctgcagtacaccttgtgg ttgggcaaaaatggcatctctgagtttcagtcggtcaaagctgaaattgaagttcagcat caggtcaatggcaacctgcagaaccgaaacgatgaaatgttcgctgaaattgatgacctt cgccaaggactagacgcaatcgaagagcgcgctcgtcacgaactgggaatggtaaaagaa ggtgagacgttttaccgcattgtcggagatgacaactga

DBGET integrated database retrieval system