Vairimorpha necatrix: VNE69_05233 Help Entry VNE69_05233       CDS       T10154                                  Name (RefSeq) Rho-related GTP-binding protein   KO K04393   cell division control protein 42 Organism vnx  Vairimorpha necatrix Pathway vnx04011   MAPK signaling pathway - yeast vnx04144   Endocytosis vnx04517   IgSF CAM signaling vnx04518   Integrin signaling vnx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vnx00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     VNE69_05233   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     VNE69_05233    04518 Integrin signaling     VNE69_05233  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     VNE69_05233  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     VNE69_05233  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vnx04131]     VNE69_05233    03036 Chromosome and associated proteins [BR:vnx03036]     VNE69_05233   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vnx04147]     VNE69_05233    04031 GTP-binding proteins [BR:vnx04031]     VNE69_05233 Membrane trafficking [BR:vnx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     VNE69_05233  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     VNE69_05233   Macropinocytosis    Ras GTPases     VNE69_05233 Chromosome and associated proteins [BR:vnx03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     VNE69_05233 Exosome [BR:vnx04147]  Exosomal proteins   Exosomal proteins of microglial cells    VNE69_05233   Exosomal proteins of breast milk    VNE69_05233 GTP-binding proteins [BR:vnx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     VNE69_05233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU MMR_HSR1 Peptidase_S9 RsgA_GTPase Arf CdhD AAA_22 PcrB SNU71_RBD AAA_7 Motif Other DBs NCBI-GeneID:  90541457 NCBI-ProteinID:  XP_065329789 UniProt:  A0AAX4JCI5 LinkDB All DBs Position 5:1128335..1128874 Genome browser AA seq 179 aa AA seqDB search MRTIKLVFVGDNSVGKTWLIRTYLSNETPSGYVSTIFDNFGTRIQYKEEYYMLSIHDTAG VSEWSKTNTLSHQQTDVFIVCFSVDDTDTFNNAVKFVDKLRRYDVPIILCATKADLRDSR VVDASVSNHSAARLGCYDYIETSSVDFKNVRRVFDTACEAAIEPKDYGTSKCCGIFYCC NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgaggactatcaagctggtctttgtaggggacaattctgtagggaagacttggcttatt cggacatatttgagcaatgagacgccaagtggatatgtcagcacaatcttcgacaacttc gggacaagaatccagtacaaagaagaatattatatgttaagcatccacgacacagcaggg gtcagtgaatggagcaagaccaacactctgtctcatcagcagacagacgtctttatcgtc tgtttctctgtagacgacactgacacatttaataatgcagtcaagtttgtagacaaattg aggcgatatgatgtcccaataatcttgtgcgctactaaggccgacttgagagatagtcga gtagtagacgcgagtgtgtctaatcattcggccgcgagactggggtgttatgattatatt gagacatcatctgtagacttcaaaaatgtacggagggtatttgacacggcatgtgaagcg gccatagagcctaaggattatgggacaagtaaatgttgtggaatattttattgttgttaa

DBGET integrated database retrieval system