Vairimorpha necatrix: VNE69_08015 Help Entry VNE69_08015       CDS       T10154                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism vnx  Vairimorpha necatrix Pathway vnx03010   Ribosome vnx04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:vnx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     VNE69_08015   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     VNE69_08015  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:vnx03011]     VNE69_08015    04121 Ubiquitin system [BR:vnx04121]     VNE69_08015 Ribosome [BR:vnx03011]  Ribosomal proteins   Eukaryotes    Large subunit     VNE69_08015   Archaea     VNE69_08015 Ubiquitin system [BR:vnx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    VNE69_08015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Ubiquitin_5 Rad60-SLD_2 TBK1_ULD UBL_UBAC1 OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  90542091 NCBI-ProteinID:  XP_065330402 UniProt:  A0AAX4JE23 LinkDB All DBs Position 8:87742..87975 Genome browser AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVDPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLNDYN IQKESTLHLVLRLRGGY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcaaatatttgtaaaaacactcacaggaaaaaccatcactttagaagtcgatccaagt gactctatagaaaatgtaaaggctaaaatacaagataaagaaggaattcctccagaccaa cagagacttatattcgcaggaaaacaacttgaagatggaagaacactcaatgactataat attcaaaaagaaagtactttacatttagtattgagactgagaggtggatattaa

DBGET integrated database retrieval system