Vibrio ostreae: KNV97_08030 Help Entry KNV97_08030       CDS       T08661                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vos  Vibrio ostreae Pathway vos01100   Metabolic pathways vos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KNV97_08030 (acpP)    00074 Mycolic acid biosynthesis     KNV97_08030 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KNV97_08030 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Motif Other DBs NCBI-ProteinID:  QXO18222 UniProt:  A0A975UC49 LinkDB All DBs Position 1:383322..383555 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNEASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVNSAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcgttgaacagctgggtgtagacgaa gcagaagttaaaaacgaagcttctttcgttgaagacctaggtgctgattctcttgacact gttgagctggttatggctcttgaagaggaattcgacactgagattcctgatgaagaagca gagaaaatcactactgttcaagctgcgatcgactacgtaaacagcgctcagtaa

DBGET integrated database retrieval system