Vogesella sp. XCS3: LCH97_00025 Help Entry LCH97_00025       CDS       T07617                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vox  Vogesella sp. XCS3 Pathway vox01100   Metabolic pathways vox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LCH97_00025 (acpP)    00074 Mycolic acid biosynthesis     LCH97_00025 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LCH97_00025 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF5783 DUF1896 Ribosomal_L50 DUF7127 DUF1493 Motif Other DBs NCBI-ProteinID:  UDM17106 LinkDB All DBs Position 3201..3440 Genome browser AA seq 79 aa AA seqDB search MENIEARVKKIVAEQLGVNEAEVKIDSSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVKQAVDYVTAHLNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaaacatcgaagcgcgcgttaagaagatcgttgccgagcaactgggcgtgaacgaa gccgaagtaaaaatcgactcctcgttcgtggacgatctgggcgctgactctctggacacc gttgagctggtaatggctctggaagaagagttcgagtgcgagattccggatgaagaagcc gagaaaatcaccaccgttaagcaggctgttgactacgtaacagctcacctgaacaagtaa

DBGET integrated database retrieval system