Vogesella sp. XCS3: LCH97_18425 Help Entry LCH97_18425       CDS       T07617                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism vox  Vogesella sp. XCS3 Brite KEGG Orthology (KO) [BR:vox00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vox03032]     LCH97_18425    03036 Chromosome and associated proteins [BR:vox03036]     LCH97_18425    03400 DNA repair and recombination proteins [BR:vox03400]     LCH97_18425 DNA replication proteins [BR:vox03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LCH97_18425 Chromosome and associated proteins [BR:vox03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LCH97_18425 DNA repair and recombination proteins [BR:vox03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LCH97_18425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Myc-LZ Motif Other DBs NCBI-ProteinID:  UDM18847 LinkDB All DBs Position unnamed:114615..114917 Genome browser AA seq 100 aa AA seqDB search MSKKDVLKAMQEEMAIQGYSYSLREIEGFVDAYNEMLYKLLSSGSSVQIPKVGTFKVSLR AERTCRNPKSGVSVPVPAQFATKFQVSNILKTKLQQLRAQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgagcaagaaagatgtactcaaggctatgcaggaagagatggctattcaaggctacagc tactccttgcgtgagattgagggctttgtagatgcatataacgagatgctctacaaattg ctgtcctcagggtcgtccgtgcaaattcccaaggttggaaccttcaaggtgagtctccga gctgagcgaacctgccgaaacccgaagtctggggtgagcgttccggtgccggcgcagttt gctacgaagttccaagtgtccaatatcctcaaaactaagttgcagcagctgcgagcgcag taa

DBGET integrated database retrieval system