KEGG   Vpept: 1490001-2
Entry
1490001-2         CDS       T49000                                 
Symbol
PR
Name
(KEGG) HIV-2 protease
  KO
K22599  HIV protease [EC:3.4.23.16 3.4.23.47]
Virus
11709  Human immunodeficiency virus 2
SSDB
Motif
Pfam: RVP gag-asp_proteas Asp_protease_2 Actin
Other DBs
NCBI-ProteinID: NP_663784
GB: NC_001722
LinkDB
AA seq 99 aa
PQFSLWKRPVVTAYIEDQPVEVLLDTGADDSIVAGIELGDNYTPKIVGGIGGFINTKEYK
NVEIKVLNKRVRATIMTGDTPINIFGRNILTALGMSLNL
Comment
vg:1490001 513..611

DBGET integrated database retrieval system