Vibrio parahaemolyticus BB22OP: VPBB_0197
Help
Entry
VPBB_0197 CDS
T02409
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
vpb
Vibrio parahaemolyticus BB22OP
Pathway
vpb00770
Pantothenate and CoA biosynthesis
vpb01100
Metabolic pathways
vpb01240
Biosynthesis of cofactors
Module
vpb_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
vpb00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
VPBB_0197
Enzymes [BR:
vpb01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
VPBB_0197
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AGB08721
LinkDB
All DBs
Position
1:215776..216258
Genome browser
AA seq
160 aa
AA seq
DB search
MKVIYPGTFDPVTNGHLNLIERTHEMFDEVVIGVAASPSKNTMFTLEERVALMEEVVAHL
PGVTVKGFSGLLVDFARQEQAKVLIRGLRTTVDFEYEFGLTNMYRKLLPGIESVFLTPEE
EFAFLSSTIVREVAIHGGSIEQFVPAAVANAIEKKVNERQ
NT seq
483 nt
NT seq
+upstream
nt +downstream
nt
atgaaagtcatttacccaggtacatttgatccagtgaccaatggtcacttaaatcttatc
gagcgcactcatgaaatgtttgatgaagtcgttattggagtagctgcaagcccttcaaag
aacactatgtttacattggaagaacgcgtcgctttgatggaagaggtagtggcacattta
cctggcgtgacagtaaaagggttttctggattgttagtggattttgctcgccaagaacaa
gccaaagtgctgattcgtgggttaagaacgacagtcgactttgagtatgagtttggtttg
actaacatgtatcgaaaactactacctgggattgagagtgtatttctgactccagaagaa
gagtttgcctttttatcttcgaccatcgtgcgtgaagttgctatccatggcggcagtatt
gagcagttcgttcccgcggccgttgctaacgctattgagaagaaagtaaatgaaagacag
taa
DBGET
integrated database retrieval system