Vibrio parahaemolyticus BB22OP: VPBB_1887 Help Entry VPBB_1887         CDS       T02409                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vpb  Vibrio parahaemolyticus BB22OP Pathway vpb01100   Metabolic pathways vpb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VPBB_1887    00074 Mycolic acid biosynthesis     VPBB_1887   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VPBB_1887 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  AGB10359 LinkDB All DBs Position 1:complement(2107909..2108142) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVNSAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcattgttgaacagctaggtgtagacgaa gcagaagttaaaaacgaagcttctttcgttgatgatctaggtgctgattctctagacact gtagaactagttatggctctagaagaggaattcgacactgagattcctgatgaagaagct gagaagatcactactgttcaagctgcaatcgactacgtaaacagcgctcagtaa

DBGET integrated database retrieval system