Vicugna pacos (alpaca): 102525337 Help Entry 102525337         CDS       T08098                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism vpc  Vicugna pacos (alpaca) Pathway vpc04140   Autophagy - animal vpc04144   Endocytosis vpc04152   AMPK signaling pathway vpc04530   Tight junction vpc04972   Pancreatic secretion vpc05014   Amyotrophic lateral sclerosis vpc05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102525337 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102525337 (RAB8A)    04140 Autophagy - animal     102525337 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102525337 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     102525337 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102525337 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     102525337 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vpc04131]     102525337 (RAB8A)    03036 Chromosome and associated proteins [BR:vpc03036]     102525337 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102525337 (RAB8A)    04031 GTP-binding proteins [BR:vpc04031]     102525337 (RAB8A) Membrane trafficking [BR:vpc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102525337 (RAB8A)  Autophagy   Other autophagy associated proteins     102525337 (RAB8A) Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102525337 (RAB8A) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102525337 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102525337 (RAB8A)   Exosomal proteins of colorectal cancer cells    102525337 (RAB8A) GTP-binding proteins [BR:vpc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102525337 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 SRPRB DUF3963 Septin DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  102525337 NCBI-ProteinID:  XP_006199169 UniProt:  A0A6I9I194 LinkDB All DBs Position 22 AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSRERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattcggaccatagagctcgatggcaagagaattaaactacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcttactacaggggc gcgatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcggaacattgaggagcacgcctccgcagatgtcgaaaagatgatactcggg aacaagtgcgacgtgaacgacaagagacaagtttccagggaacggggagagaagctggcc ctggactatggaatcaagttcatggaaaccagcgcaaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system