KEGG   Vicugna pacos (alpaca): 102525363
Entry
102525363         CDS       T08098                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
vpc  Vicugna pacos (alpaca)
Pathway
vpc01521  EGFR tyrosine kinase inhibitor resistance
vpc01522  Endocrine resistance
vpc04010  MAPK signaling pathway
vpc04012  ErbB signaling pathway
vpc04014  Ras signaling pathway
vpc04015  Rap1 signaling pathway
vpc04062  Chemokine signaling pathway
vpc04068  FoxO signaling pathway
vpc04071  Sphingolipid signaling pathway
vpc04072  Phospholipase D signaling pathway
vpc04137  Mitophagy - animal
vpc04140  Autophagy - animal
vpc04144  Endocytosis
vpc04150  mTOR signaling pathway
vpc04151  PI3K-Akt signaling pathway
vpc04210  Apoptosis
vpc04211  Longevity regulating pathway
vpc04213  Longevity regulating pathway - multiple species
vpc04218  Cellular senescence
vpc04360  Axon guidance
vpc04370  VEGF signaling pathway
vpc04371  Apelin signaling pathway
vpc04510  Focal adhesion
vpc04540  Gap junction
vpc04550  Signaling pathways regulating pluripotency of stem cells
vpc04625  C-type lectin receptor signaling pathway
vpc04630  JAK-STAT signaling pathway
vpc04650  Natural killer cell mediated cytotoxicity
vpc04660  T cell receptor signaling pathway
vpc04662  B cell receptor signaling pathway
vpc04664  Fc epsilon RI signaling pathway
vpc04714  Thermogenesis
vpc04720  Long-term potentiation
vpc04722  Neurotrophin signaling pathway
vpc04725  Cholinergic synapse
vpc04726  Serotonergic synapse
vpc04730  Long-term depression
vpc04810  Regulation of actin cytoskeleton
vpc04910  Insulin signaling pathway
vpc04912  GnRH signaling pathway
vpc04915  Estrogen signaling pathway
vpc04916  Melanogenesis
vpc04917  Prolactin signaling pathway
vpc04919  Thyroid hormone signaling pathway
vpc04921  Oxytocin signaling pathway
vpc04926  Relaxin signaling pathway
vpc04929  GnRH secretion
vpc04933  AGE-RAGE signaling pathway in diabetic complications
vpc04935  Growth hormone synthesis, secretion and action
vpc05010  Alzheimer disease
vpc05022  Pathways of neurodegeneration - multiple diseases
vpc05034  Alcoholism
vpc05132  Salmonella infection
vpc05160  Hepatitis C
vpc05161  Hepatitis B
vpc05163  Human cytomegalovirus infection
vpc05165  Human papillomavirus infection
vpc05166  Human T-cell leukemia virus 1 infection
vpc05167  Kaposi sarcoma-associated herpesvirus infection
vpc05170  Human immunodeficiency virus 1 infection
vpc05200  Pathways in cancer
vpc05203  Viral carcinogenesis
vpc05205  Proteoglycans in cancer
vpc05206  MicroRNAs in cancer
vpc05207  Chemical carcinogenesis - receptor activation
vpc05208  Chemical carcinogenesis - reactive oxygen species
vpc05210  Colorectal cancer
vpc05211  Renal cell carcinoma
vpc05213  Endometrial cancer
vpc05214  Glioma
vpc05215  Prostate cancer
vpc05216  Thyroid cancer
vpc05218  Melanoma
vpc05219  Bladder cancer
vpc05220  Chronic myeloid leukemia
vpc05221  Acute myeloid leukemia
vpc05223  Non-small cell lung cancer
vpc05224  Breast cancer
vpc05225  Hepatocellular carcinoma
vpc05226  Gastric cancer
vpc05230  Central carbon metabolism in cancer
vpc05231  Choline metabolism in cancer
vpc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vpc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vpc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102525363 (HRAS)
   04012 ErbB signaling pathway
    102525363 (HRAS)
   04014 Ras signaling pathway
    102525363 (HRAS)
   04015 Rap1 signaling pathway
    102525363 (HRAS)
   04370 VEGF signaling pathway
    102525363 (HRAS)
   04371 Apelin signaling pathway
    102525363 (HRAS)
   04630 JAK-STAT signaling pathway
    102525363 (HRAS)
   04068 FoxO signaling pathway
    102525363 (HRAS)
   04072 Phospholipase D signaling pathway
    102525363 (HRAS)
   04071 Sphingolipid signaling pathway
    102525363 (HRAS)
   04151 PI3K-Akt signaling pathway
    102525363 (HRAS)
   04150 mTOR signaling pathway
    102525363 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102525363 (HRAS)
   04140 Autophagy - animal
    102525363 (HRAS)
   04137 Mitophagy - animal
    102525363 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102525363 (HRAS)
   04218 Cellular senescence
    102525363 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102525363 (HRAS)
   04540 Gap junction
    102525363 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102525363 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102525363 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102525363 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    102525363 (HRAS)
   04660 T cell receptor signaling pathway
    102525363 (HRAS)
   04662 B cell receptor signaling pathway
    102525363 (HRAS)
   04664 Fc epsilon RI signaling pathway
    102525363 (HRAS)
   04062 Chemokine signaling pathway
    102525363 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102525363 (HRAS)
   04929 GnRH secretion
    102525363 (HRAS)
   04912 GnRH signaling pathway
    102525363 (HRAS)
   04915 Estrogen signaling pathway
    102525363 (HRAS)
   04917 Prolactin signaling pathway
    102525363 (HRAS)
   04921 Oxytocin signaling pathway
    102525363 (HRAS)
   04926 Relaxin signaling pathway
    102525363 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    102525363 (HRAS)
   04919 Thyroid hormone signaling pathway
    102525363 (HRAS)
   04916 Melanogenesis
    102525363 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102525363 (HRAS)
   04726 Serotonergic synapse
    102525363 (HRAS)
   04720 Long-term potentiation
    102525363 (HRAS)
   04730 Long-term depression
    102525363 (HRAS)
   04722 Neurotrophin signaling pathway
    102525363 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102525363 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102525363 (HRAS)
   04213 Longevity regulating pathway - multiple species
    102525363 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102525363 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102525363 (HRAS)
   05206 MicroRNAs in cancer
    102525363 (HRAS)
   05205 Proteoglycans in cancer
    102525363 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    102525363 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102525363 (HRAS)
   05203 Viral carcinogenesis
    102525363 (HRAS)
   05230 Central carbon metabolism in cancer
    102525363 (HRAS)
   05231 Choline metabolism in cancer
    102525363 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102525363 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102525363 (HRAS)
   05225 Hepatocellular carcinoma
    102525363 (HRAS)
   05226 Gastric cancer
    102525363 (HRAS)
   05214 Glioma
    102525363 (HRAS)
   05216 Thyroid cancer
    102525363 (HRAS)
   05221 Acute myeloid leukemia
    102525363 (HRAS)
   05220 Chronic myeloid leukemia
    102525363 (HRAS)
   05218 Melanoma
    102525363 (HRAS)
   05211 Renal cell carcinoma
    102525363 (HRAS)
   05219 Bladder cancer
    102525363 (HRAS)
   05215 Prostate cancer
    102525363 (HRAS)
   05213 Endometrial cancer
    102525363 (HRAS)
   05224 Breast cancer
    102525363 (HRAS)
   05223 Non-small cell lung cancer
    102525363 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102525363 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    102525363 (HRAS)
   05161 Hepatitis B
    102525363 (HRAS)
   05160 Hepatitis C
    102525363 (HRAS)
   05163 Human cytomegalovirus infection
    102525363 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102525363 (HRAS)
   05165 Human papillomavirus infection
    102525363 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102525363 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102525363 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102525363 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    102525363 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102525363 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102525363 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102525363 (HRAS)
   01522 Endocrine resistance
    102525363 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vpc04131]
    102525363 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpc04147]
    102525363 (HRAS)
   04031 GTP-binding proteins [BR:vpc04031]
    102525363 (HRAS)
Membrane trafficking [BR:vpc04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102525363 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102525363 (HRAS)
Exosome [BR:vpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102525363 (HRAS)
  Exosomal proteins of colorectal cancer cells
   102525363 (HRAS)
GTP-binding proteins [BR:vpc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102525363 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N G-alpha Septin Ldh_1_N CdhD
Other DBs
NCBI-GeneID: 102525363
NCBI-ProteinID: XP_015107483
UniProt: A0A6J0B423
LinkDB
Position
Unknown
AA seq 197 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVEARQAQDLARSYGIPYIETSAKTRQGRLWFRLQLRDPLGPSGTPGTQQPLALGWR
TPSTRWCERSGSTRCAS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacggaatataagctcgtagtggtgggcgccggaggcgtggggaagagcgcgctgacc
atccagctcattcagaaccacttcgtggacgagtacgaccccaccatagaggactcctac
cggaagcaagtagtcattgatggggagacatgcctgctggacatcctggacacagcaggc
caggaggagtacagtgctatgcgggaccaatacatgcgcaccggggagggcttcctctgt
gtgttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcccgcaccgtggaggctcggcaagcccaggacctcgcccgcagctacggcatcccc
tacattgagacttcagccaagactcgccagggcagactctggttcaggctccagctccgg
gaccccctgggaccctccgggacccccgggacccagcagcccctggcgctggggtggagg
acgccttctacacgctggtgcgagagatccggcagcacaaggtgcgcaagctga

DBGET integrated database retrieval system