Vicugna pacos (alpaca): 102525692 Help Entry 102525692         CDS       T08098                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism vpc  Vicugna pacos (alpaca) Brite KEGG Orthology (KO) [BR:vpc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vpc03041]     102525692 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102525692 (UBL5) Spliceosome [BR:vpc03041]  Complex B   Other components    Complex B specific factors     102525692 (UBL5) Cytokines and neuropeptides [BR:vpc04052]  Neuropeptides   Unclassified    102525692 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  102525692 NCBI-ProteinID:  XP_006206323 UniProt:  A0A6I9IBK4 LinkDB All DBs Position 22 AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtccgagttaagtgcaacact gatgacaccatcggggaccttaagaagctgattgcagcccaaactggcacccgctggaac aagatcgtattgaagaagtggtacacgatttttaaggaccacgtgtctctgggggactat gaaatccatgatgggatgaacctggagctttattaccagtag

DBGET integrated database retrieval system